PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WOX
Protein Properties Length: 343aa    MW: 37569.4 Da    PI: 5.2275
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73746.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.34.6e-1745105257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 ++R+++ +eq+++Le  F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  EPS73746.1  45 KPRWNPRPEQIRILEGIFNSgMVNPPRDEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 105
                 89*****************99*************************************995 PP

2Wus_type_Homeobox111.93.4e-3644107265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+P+peQi+iLe +++sG+++P+++ei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++kq
         EPS73746.1  44 PKPRWNPRPEQIRILEGIFNSGMVNPPRDEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHKQ 107
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.13941106IPR001356Homeobox domain
SuperFamilySSF466891.84E-1241111IPR009057Homeodomain-like
SMARTSM003892.6E-843110IPR001356Homeobox domain
CDDcd000861.89E-744107No hitNo description
Gene3DG3DSA:1.10.10.602.8E-744112IPR009057Homeodomain-like
PfamPF000469.6E-1545105IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MSSSNRHWPS MFKSKPNHEH HHHLVAHRNS YSGKCGVEER TPEPKPRWNP RPEQIRILEG  60
IFNSGMVNPP RDEIRRIRAQ LQEYGQVGDA NVFYWFQNRK SRSKHKQRQM AKSTPPPQQQ  120
QATTAITITA TTAPSPSSPD NKETDPSTTN LVDLLNSTAN TYAPSSVQFP AEGFLFPMQQ  180
QEAVGGGGGG GGGGYGFCDG GGGFLLSELM LMSQSDSKRD ADDDAEDDDD DADDDDDGMK  240
KKKKRMSFCY AAGTSSEAAV TPGIFDLTGD DGVGPATRSS PPSTVVVFIN EVWFEIGSGP  300
FNVREAFGED AVLIQSTGHP VLTDEWGVTL QPLQHGGFYY LLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096377.11e-103PREDICTED: WUSCHEL-related homeobox 9
RefseqXP_011096378.11e-103PREDICTED: WUSCHEL-related homeobox 9
RefseqXP_011096379.11e-103PREDICTED: WUSCHEL-related homeobox 9
RefseqXP_011096381.11e-103PREDICTED: WUSCHEL-related homeobox 9
TrEMBLS8D8G80.0S8D8G8_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc02g077390.1.11e-92(Solanum lycopersicum)
STRINGVIT_10s0003g00560.t014e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59422335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-53homeobox-3
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]